PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ote100183810011
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Ocimeae; Ocimum
Family NAC
Protein Properties Length: 220aa    MW: 25393.3 Da    PI: 6.2788
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ote100183810011genomeOteDB-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1448.6e-4541351128
                           NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk....kvkaeekewyfFskrdkkyatgkrknra 77 
                                   l pGfrF Pt+eelv++yL +k++g++ ++++vi+ vdiy+++PwdLp+     +  e+++w+fFs+r++++a+g r+nr 
  Ote100183810011|100183810011   4 LLPGFRFYPTEEELVSFYLFHKLRGTRSDIDRVIPVVDIYDYNPWDLPQlggeVCGVESEQWFFFSPRQEREARGGRPNRL 84 
                                   579***************************99****************656754445788********************* PP

                           NAM  78 tksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                                   t++gyWkatg+  +v+s++++++g k+t+vfy grap+g kt W m+ey++
  Ote100183810011|100183810011  85 TTEGYWKATGSPGDVYSSQNSVIGRKRTMVFYVGRAPNGAKTIWKMNEYKA 135
                                   *************************************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.22E-493158IPR003441NAC domain
PROSITE profilePS5100549.1244158IPR003441NAC domain
PfamPF023651.9E-216134IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 220 aa     Download sequence    Send to blast
MDDLLPGFRF YPTEEELVSF YLFHKLRGTR SDIDRVIPVV DIYDYNPWDL PQLGGEVCGV  60
ESEQWFFFSP RQEREARGGR PNRLTTEGYW KATGSPGDVY SSQNSVIGRK RTMVFYVGRA  120
PNGAKTIWKM NEYKAALQSL SPNPQLSEEL SLCRIYKKSR SLRAFDRRPA SSQPQQQEYV  180
PAETTTQIPT NVVNTFQSLQ TENDQSCGWD YDHLINSFHN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A3e-36416117168NO APICAL MERISTEM PROTEIN
1ut4_B3e-36416117168NO APICAL MERISTEM PROTEIN
1ut7_A3e-36416117168NO APICAL MERISTEM PROTEIN
1ut7_B3e-36416117168NO APICAL MERISTEM PROTEIN
4dul_A3e-36416117168NAC domain-containing protein 19
4dul_B3e-36416117168NAC domain-containing protein 19
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011077925.14e-86PREDICTED: NAC domain-containing protein 90-like
SwissprotQ9FMR32e-68NAC90_ARATH; NAC domain-containing protein 90
TrEMBLA0A068UQS79e-88A0A068UQS7_COFCA; Uncharacterized protein
STRINGGLYMA19G38211.13e-81(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA24942357